Sunday, March 25, 2012

Passing FCAT Writing Test 2012

Passing the FCAT 2.0 Writing Assessments 2013: How to help your students pass the FCAT writing assessment.

Passing The FCAT writing test is a responses to a prompt ether persuasive, narrative, or expository. Three areas that needed equal attention on past FCAT writing test and should be mastered to pass the FCAT writing tests in 4th, 8th and 10th grade.

2013 FCAT 2.0 Writing Prompts and Sample Essays

Grade 4
Writing to Tell a Story (Narrative)
Suppose you won something special.
Think about winning something special.
Now write a story about what happened when you won something special.
Grade 8
Writing to Persuade (Persuasive)
Writing Situation:
Suppose you could convince a famous person to visit your town.
Directions for Writing:
Think about why this person should visit your town.
Now write to convince this person to visit your town.
Grade 10
Writing to Explain (Expository)
Writing Situation:
Suppose you are a reporter and have been assigned to interview a fascinating person of your choice.
Directions for Writing:
Think about a person you would choose to interview.
Now write to explain why you would choose to interview this person.
Additional Resources


2010 FCAT writing prompts

Grade 4 Writing to Tell a Story (Narrative) 2010 prompts
The Grade 4 narrative prompt directed the student to write a story about a day some 4th grade students made lunch for the school.

Grade 8 Writing to Explain (Expository)
 The Grade 8 expository prompt directed the student to explain the biggest change he or she has experienced from elementary to middle school.

Grade 10 Writing to Persuade (Persuasive)
The Grade 10 expository prompt directed the student to explain how being famous would affect someone's life. 


2011 FCAT writing prompts

Grade 4 Writing to Explain (Expository) The Grade 4 expository prompt directed the student to explain the kind of weather he or she likes.

Grade 8 Writing to Explain (Expository) The Grade 8 expository prompt directed the student to think about a place he or she likes to go again and again and explain why he or she likes to go to this place.

Grade 10 Writing to Explain (Expository)
The Grade 10 persuasive prompt directed the student to persuade state legislators whether school libraries should provide Internet access for students.


How to Pass any State Writing Test: Tips on Passing Writing Test Grades 3, 4, 5, 6, 7, 8 and 9. 

State standardized writing test are divided into two parts: Writing test part one, response to a prompt, writing test part two multiple choice English Language Arts test. 

Doing your Best on The Multiple Choice Part!

Students mast have time to prepare for state writing test, so if you are studying the night before your test, you need to study the ELA tier 3 academic testing vocabulary.

The fastest way to prepare for the multiple choice English Language Arts portion of the test is playing games.
Reading / ELA Vocabulary Games 

Doing your Best on The Written Response Part! 


The real secret to passing ALL State writing test is thinking like the Fins (people of Finland), formative practice, formative practice, formative practice test with a well thought-out graphic organizer, using a similar or previously released testing instrument if possible. School districts that administer High Stakes Test usually administer some form of summative assessments looking at the final scores, skipping all the writing steps that students need to know when writing competently. Formative writing test gives students and the teachers more ways to evaluate the entire writing process. My students practice and rehearse “writing success” with tools designed to make the writing process kid friendly.

Sit down with your team and design a graphic organizer that the kids can use. Start out with a simplified version and gradually make it more structured and competent.

The students in my class use a simple STEAL chart with pictures of lips for the S in speech, a picture of a brain for the T in thoughts and so on. Again the secret is formative assessment with lots of feedback and a graphic organizer to match the assessment.
In Short! Students must practice using a systematic graphic organizer that covers expository, persuasive, and or narrative writing depending on the test they take. Students must also learn the critical tier 3 vocabulary that they will find on the multiple choice section of the writing test. Students must be given the tools to succeed!

I use a STEAL Characterization chart to enhance the students understanding of the structures of writing whenever possible and to prepare students for state testing. My students have to take three normed writing assessment every year. Teaching them to use a systematic graphic organizer and sorry to say formulaic writing process has gained my students some of the highest writing scores in the state! Our class has the highest number of students that exceed and meets compared to other Title one schools. The past 4 years my students have had an amazing passing rate of 94% on state writing test. I also expose my students daily to the academic writing vocabulary.

Best Practices in the Teaching of Writing
A Prezi on Expository writing 4th Grade Expository Benchmark Model 
Six Traits Writers Work Shop Handbook

Types of Writing Test

Narrative writing is a constructive format that describes a sequence of non-fictional or fictional events in a story. The word "story" may be used as a synonym of "narrative", but can also be used to refer to the sequence of events described in a narrative. A narrative can also be told by a character within a larger narrative.

Expository writing is a type of writing where the purpose is to inform, describe, explain, or define the author's subject to the reader. Expository text is meant to deposit information and is the most frequently used type of writing by students in colleges, high schools, middle schools, elementary schools and universities. A well-written exposition remains focused on its topic and lists events in chronological order. Examples of expository writing include driving directions and instructions on performing a task. Key words such as first, after, next, then, last, before that, and usually signal sequential writing. Second-person instructions with "you" are acceptable.However, the use of first-person pronouns should be avoided ( For example, I, I think etc...). Expository essays should not reveal the opinion of the writer.

Persuasive writing, also referred to as a creative writing or an argument, is a piece of writing in which the writer uses words to convince the reader of his/her view regarding an issue. Persuasive writing sometimes involves convincing the reader to perform an action, or it may simply consist of an argument(s) convincing the reader of the writer’s point of view. Persuasive writing is one of the most used writing types in the world. Persuasive writers employ many techniques to improve their argument and show support for their claim. Simply put, persuasive writing is "an essay that offers and supports an opinion".
 
Please use the sample STEAL chart below or design your own to start getting your students ready to pass the FCAT, CRCT, MCAS, PASS, CRT, AIMS, STAAR, TAKS, PAWS, STA 10, CSAP, CMT, ISTEP, SOL, NJ ASK, NC EOG, OAA, ... Writing Test this spring.


Academic ELA Vocabulary Tier 3 Writing Glossary
PDF
Word

Sample of a few of my Graphic Organizers that students train on.

Develop your own graphic organizers that helps your students master expository, personal narrative, and or persuasive writing.

“The Silver Bullet” STEAL Graphic Organizer | Characterization Chart 
96% Meets or Exceeds on State Writing Test | 25% Exceeding on State Writing Test 

EXPOSITION| RISING ACTION| CLIMAX| FALLING ACTION| RESOLUTION
Narrative and a bit of Expressive writing  
WORD CHOICE
Verbs and Adverbs
EXPOSITION Topic Sentence W.W.W. Who, What, and WHY!  What: My first roller coaster ride Who: I am Alone Why: My parents are afraid to ride the Matterhorn
Topic Sentence It introduces the main idea of the paragraph
WORD CHOICE
Nouns and Adjectives
Debated decided dedicated valued chose cleaned
S – Speech/ Speaking / Dialogue
Speech What does the character say (YOU, FRIENDS, FAMILY)?
swift ancient modern bitter sweet alert sane
vaulted viewed visualized volunteered Captured cared for carried caught categorized challenged
T – thoughts/feelings/attitudes
Thoughts What is important about the character’s thoughts and feelings (YOU, FRIENDS, FAMILY)?
attractive sticky fuzzy giant fresh  graceful harsh whispering puny harsh noisy quiet shrill
championed changed checked cleared closed coached commanded commended
E – emotions/effects on others
Effect How do other characters feel or behave or react to the characters?
teeny massive careful cheap expensive rainy crystal sore dangerous combative
concentrated confronted constructed consulted continued controlled convinced cooperated copied corrected counseled
A – actions
Actions What does the character do? How does the character behave?
weary dull drab dim aggressive mellow fancy excited scared filthy superior lazy excited hungry crazy
created customized joined judged observed tackled talked targeted tasted taught obtained offered translated


L – looks/ settings/ imagery/ what
Looks What do you see? What do the characters look like? How does the character dress?
poor rich busy anxious steep skinny petite tiny miniscule salty delicious terrible dead alive huge tremendous elderly handsome ugly beautiful shiny
WORD CHOICE
Verbs and Adverbs

RISING ACTION Topic Sentence W.W.W. Who, What, and WHY!
WORD CHOICE
Nouns and Adjectives

S – Speech/ Speaking / Dialogue


T – thoughts/feelings


E – effects/emotions on others


A – actions


L – looks/ settings

WORD CHOICE
Verbs and Adverbs
RISING ACTION Topic Sentence W.W.W. Who, What, and WHY!
WORD CHOICE
Nouns and Adjectives

S – Speech/ Speaking / Dialogue


T – thoughts/feelings


E – effects/emotions on others


A – actions


L – looks/ settings


“The Silver Bullet II” STEAL Students Graphic Organizer
96% Meets or Exceeds on State Writing Test | 25% Exceeding on State Writing Test

Expository Writing with a bit of Narrative to meet the Six Traits of Writing
 Narrative with a bit of Expository Structures
WORD CHOICE

INTRODUCTION Topic Sentence It introduces the main idea of the paragraph
Ideas

POINT #1 (SUPPORTING DETAIL)
S – Speech/ Speaking / Dialogue
elaboration (mini-story)Speech What are people saying (YOU, FRIENDS, FAMILY)?


POINT #2 (SUPPORTING DETAIL)
T – thoughts/feelings/attitudes
elaboration (mini-story)
Thoughts What is important about the  thoughts and feelings (YOU, FRIENDS, FAMILY)?


POINT #3 (SUPPORTING DETAIL)
E –effects on others / emotions/
elaboration (mini-story)
Effect How do other characters feel or behave or react to the characters?


POINT #4 (SUPPORTING DETAIL)
A – actions
Actions What are people doing? What are their actions? How does the character behave?


POINT #5 (SUPPORTING DETAIL)
L – looks/ settings/ imagery/
Looks What do you see? What do the  events and action look like?


CONCLUSION / Transitions



Persuasive Essay Graphic Organizer
HOTEL Chart

Prompt Topic

Should all kids go to academic summer camp?

Hook |
pester / persuade / plea
Academic summer camps increases academic performance, resiliency, critical thinking, and problem solving skills.
Opinion |
judgment / attitude / belief
Giving all students a leg up is critical if we want to remain a first world nation not slide into a third world nation.
Thoughts | thoughts/feelings/attitudes
We need to find a way that all students have the opportunity to attend summer camp or “SuperCamp” not just a very small percentage of rich children.
Emotions | emotions/effects on others
Effect

If we are going to sentence our children to 16 years of school we should have the decency to make it a truly amazing 16 years not just testing factories.
Logic | deduce/convince/  reason 
The new Common Core Standards are designed to help bridge the academic achievement gap and prepare US students for the increasingly complex information age but they are just words if students are not exposed to many academic opportunities.



Reading fcat practice test 4th grade

Grade 4
Test Book (2MB)
Test Book with Answers (2MB)

This is a list of all the FCAT Released Tests
Reading
Grade 5
Test Book (1MB)
Test Book with Answers (1MB)

Grade 6
Test Book (2MB)
Test Book with Answers (2MB)

Math
Grade 5
Test Book (2MB)
Test Book with Answers (2MB)

Grade 6
Test Book (1MB)
Test Book with Answers (1MB)

2006 FCAT Released Tests
Reading

Grade 3
Test Book (1MB)
Test Book with Answers (2MB)

Grade 7
Test Book (947KB)
Test Book with Answers (1022KB)

Grade 9
Test Book (1MB)
Test Book with Answers (1MB)

Grade 10
Test Book (2MB)
Test Book with Answers (1MB)

Math
Grade 3
Test Book (865KB)
Test Book with Answers (914KB)

Grade 7
Test Book (628KB)
Test Book with Answers (685KB)

Grade 9
Test Book (784KB)
Test Book with Answers (831KB)

Grade 10
Test Book (851KB)
Test Book with Answers (928KB)

2005 FCAT Released Tests

Reading
Grade 4
Test Book (2MB)
Test Book with Answers (2MB)

Grade 8
Test Book (2MB)
Test Book with Answers (2MB)

Grade 10
Test Book (713KB)
Test Book with Answers (803KB)

Math
Grade 4
Test Book (977KB)
Test Book with Answers (1MB)

Grade 8
Test Book (1MB)
Test Book with Answers (1MB)

Grade 10
Test Book (846KB)
Test Book with Answers (905KB)

Friday, March 23, 2012

The First 1000 Words of English

The First 1000 Words of English 

English Language Learners, ESL, ELL and remedial reading students need to master the Tier 1 English Vocabulary found in the GSL. The 2000 words in the GSL make up 95% of spoken English and 85% or written English!

The General Service List (GSL) is a list of roughly 2000 words published by Michael West in 1953. The words were selected to represent the most frequent words of English and were taken from a corpus of written English. The target audience was and is English language learners and ESL teachers. To maximize the utility of the list, some frequent words that overlapped broadly in meaning with words already on the list were omitted. In the original publication the relative frequencies of various senses of the words were also included.




General Service Word List West 1953

A able about above accept accord account across act actual add address admit adopt advance advantage adventure affair afford after again against age agent ago agree air all allow almost alone along already also although always among amount an ancient and animal another answer any appear apply appoint arise arm army around arrive art article as ask association at attack attempt average away back bad ball bank bar base battle be bear beauty because become bed before

begin behind being believe belong below beneath best better between beyond big bill bird bit black bless blood blow blue board boat body book born box boy branch bread break bridge bright bring broad brother build burn business but buy by call camp can canal capital captain car care carry case castle cause center century certain chair chance change character charge chief child choose church circle city claim class clean clear close cloud club coal coast coin cold college colony color come comfort command committee common company compare

court cover creature crop cross crowd crown cry current custom cut dance danger dare dark date daughter day dead deal dear debt decide declare deep defeat degree deliver demand department depend describe desert desire destroy detail determine develop die difference difficult direct discover disease distance distinguish district divide do dog dollar door double down draw dream dress drink drive drop dry due duty each ear early earth east easy eat edge effect

effort egg either elect else empire employ end enemy English enjoy enough enter entire equal escape even evening event ever every evil example excellent except exchange exercise exist expect expense experience experiment explain express extend eye face fact factory fail fair faith fall familiar family famous fancy far farm fashion fast fate favor fear feed feel fellow few field fight figure fill find fine finger finish fire first fish fit fix flag floor flow fly follow for force foreign forest forget form former forth fortune free fresh friend from

front full furnish future gain game garden gas gate gather general gentle get girl give glad glass glory go God gold good grain grave great green ground grow guard gun habit hall hand handle hang happen happy hard hardly have he head health hear heat heaven heavy help her here hide high hill his history hold home honest honor hope horse hot hour house how human idea ideal if ill important impossible in inch include increase indeed independent influence instead intend interest into introduce iron it its join joy

judge just keep kill kind king know lack lady lake land language large last late latter laugh law lay lead leaf learn least leave leg less let letter level liberty library lie life lift light like likely line limit lip listen literature little live local long look lord lose lost lot love low machine main make man manner manners manufacture many march mark market marry mass master material matter may me mean measure member memory mention merchant mere metal middle might mile milk mind mine minister minute miss mistake modern

moment money month moon more moreover morning most mother motion motor mountain mouth much music must my name narrow nation native nature near necessary neck need neighbor neither never new next night no noble none nor north not note nothing notice now number object observe occasion ocean of off offer office often oil old once one only onto open operation opinion opportunity or order ordinary organize other otherwise ought out of out over owe own page pain paint paper part particular party pass past pay peace people per perfect perhaps

permanent permit person picture piece place plain plan plant play please poet point political poor popular population position possess possible post power practical practice prepare present preserve president press pretty prevent price print private problem produce product production profit program progress promise proper property propose protect prove provide public pull purpose put quality quantity queen question quiet quite race raise rank rate rather reach read ready real realize really reason receive recent recognize record red reduce refuse regard regular relation religion remain remark remember rent repeat reply report represent

republic reserve respect rest result return rich ride right ring rise river road rock roll room rough round royal ruin rule run rush safe sail sale salt same sand say scale scarce scene school science sea season seat second secret secretary see seem seize sell send sense separate serious serve set settle several shade shadow shake shall shape share she shine ship shoe shoot shore short should shout show side sign silence silver simple since sing single sir sister sit situation size skill sky slave sleep slight slow small smile

snow so society soft soil soldier some son soon sort soul sound south space speak special speed spend spirit spite sport spot spread spring square stage stand standard star start state stay steel step stick still stock stone stop store storm story straight strange stream street stretch strike strong struggle study subject substance succeed such sudden suffer sugar suggest summer sun supply support suppose sure surface surprise surround sweet sword system table take talk taste tax teach tear tell temple tend term terrible test than that the theater their them

then there therefore these they thing think this though thought through throw thus till time title to today together ton too tooth top total touch toward/s town trade train travel tree trouble true trust try turn type uncle under understand union unite university unless until up upon upper use usual valley value various very vessel victory view village virtue visit voice vote wage/s wait walk wall want war warn waste watch water wave way we wealth wear weather week welcome well west western what when where whether which while white

who whose why wide wife wild will win wind window wine wing winter wise wish with within without woman wonder wood word work world worse worth wound write wrong year yes yet yield you young

The Second 1000 words

abroad absence absolutely accident accuse accustom ache actual admire advertise advice afford afraid afternoon agriculture ahead aim airplane alike alive aloud altogether ambition amongst amuse anger angle annoy anxiety apart apologize applaud apple approve arch argue arrange arrest arrow artificial ash ashamed aside asleep astonish attend attract audience aunt autumn avenue avoid awake awkward axe baby bag baggage bake balance band bar barber bare bargain barrel basin basket bath bay beak

beam bean beard beast beat beg behave bell belt bend beneath berry bicycle bind birth bi bite bitter blade blame bless blind block boast boil bold bone border borrow bottle bottom boundary bound bow bowl brain brass brave breakfast breath bribe brick brown brush bucket bunch bundle burst bury bus bush busy butter button cage cake calculate calm camera camp canal cap cape card carriage cart cat cattle caution cave cent century ceremony chain chair chalk charm cheap cheat check cheer cheese check chicken chimney Christmas civilize clay clean clerk clever cliff climb clock cloth club coarse coat coffee collar collect comb combine commerce companion compare compete complain complicated compose confess confidence confuse congratulate connect conquer conscience conscious convenience conversation cook

cool copper copy cork corner correct cottage cough courage cousin cow coward crack crash cream creature creep crime critic crop cruel crush cultivate cup cure curious curl curse curtain curve cushion custom damage damp dance dare deaf debt decay deceive decrease deed deer defend delay delicate delight deliver descend
desert deserve desk despair devil diamond dictionary dig dinner dip dirt disappoint discipline discuss disease disgust dish dismiss disturb ditch dive donkey dot double dozen drag drawer drown drum duck dull during dust eager earn earnest ease edge educate efficient elastic elder electricity elephant empty enclose encourage engine entertain entire envelope envy especial essence everywhere

evil exact examination excellent excess excuse expense explode explore extra extraordinary extreme fade faint false fan fancy farther fashion fat fate fault favorite feast feather feed female fence fever fierce film finger firm flag flame flash flat flavor flesh float flood flour fold fond fool foot forbid forgive fork formal frame freeze frequent fright fruit fry fun funeral fur gallon gap garage gate gay generous glory goat govern grace gradual grain grammar grand grass grateful grave grease greed greet grey grind guard guess guest guide guilty habit hair hall hammer handkerchief handle harbor harm harvest haste hat hate hay heal health heap heart height

hesitate hinder hire hit hole holiday hollow holy honest hook horizon hospital host hotel humble hunger hunt hurry hurt hut ice ideal idle imagine imitate immediate immense improve industry inform ink inn inquire insect inside instant instrument insult insure intend interfere international interrupt invent invite inward jaw jealous jewel joint journey juice jump key kick kiss kitchen knee kneel knife knock knot ladder lamp lazy leaf lean left leg lend lessen lesson liberty lid limb liquid list load loaf loan lock lodging log lonely loose lot loud loyal luck lump lunch lung mad mail male manage map mat match meal meanwhile meat mechanic medicine

melt mend merchant mercy merry message mild mill miserable mistake mix model modest monkey moral moreover motion mouse mud multiply murder mystery nail narrow neat neck needle neglect nephew nest net nice niece noise nonsense noon nose noun nuisance nurse nut oar obey ocean offend omit opportunity opposite orange organ origin ornament otherwise overcome pack pad pain pair pale pan parcel pardon parent park passage paste path patient patriotic pattern pause paw pearl peculiar pen pencil penny perfect perform permanent pet photograph pick pig pigeon pile pin pinch pink pint pipe pity plaster plenty plough plural pocket poet poison police polish polite pool postpone

pot pour poverty powder practical practice praise pray preach precious prefer prejudice preserve pretend pride priest print prison probable procession produce profession program prompt pronounce proof proud pump punctual punish pupil pure purple push puzzle qualify quarrel quart quick quiet rabbit radio rail rain rake rapid rare raw ray razor recommend refer reflect refresh regret regular rejoice relieve remedy remind rent repair repeat replace reproduce reputation request rescue resign responsible restaurant retire revenge review reward ribbon rice rid ripe risk rival roar roast rob rod roof root rope rot row rub rubber rubbish rude rug ruin ruler rush rust sacred sacrifice sad saddle sake

salary sample sand satisfy sauce saucer saw scale scatter scene scissors scold scorn scrape scratch screen screw search seed seize seldom sentence severe sew shade shadow shallow shame sharp sheep sheet shelf shell shelter shield shilling shirt shock shoe shop shout shower shut sick silk sincere sink skill skin skirt slave slide slight slip slope slow smell smoke smooth snake soap socks soil solemn solid solve sore sorry soup sour sow spade spare spell spill spin spit spite splendid split spoil spoon sport staff stain stairs stamp steady steam steep steer stem stiff sting stir stockings stomach storm stove straight strap straw stretch strict

string strip stripe stuff stupid substance suck sudden sugar suit supper suspect swallow swear sweat sweep swell swim swing sympathy tail tailor tall tame tap taste taxi telegraph telephone temper temperature tempt tend tender tent terrible thank theater thick thief thin thirst thorn thorough thread threaten throat thumb thunder ticket tide tidy tie tight tin tip tire title tobacco toe tomorrow tongue tonight tool tooth tough tour towel tower toy track translate trap tray treasure treat tremble trial tribe trick trip trunk tube tune twist ugly umbrella unclear unit unity universe upper upright upset urge vain veil verb verse violent vowel voyage waist wake

wander warm warn waste wax weak weapon weather weave weed weigh wet wheat wheel whip whisper whistle whole wicked widow wine wing wipe wire witness wool worm


General Service List from Wiktionary


1-200

thebeofandatoinhehaveitthatfortheyIwithasnotonsheatbythisweyoudobutfromorwhichonewouldallwilltheresaywhomakewhencanmoreifnomanoutothersowhattimeupgoaboutthanintocouldstateonlynewyearsometakecometheseknowseeusegetlikethenfirstanyworknowmaysuchgiveoverthinkmostevenfinddayalsoafterwaymanymustlookbeforegreatbackthroughlongwheremuchshouldwellpeopledownownjustbecausegoodeachthosefeelseemhowhightooplacelittleworldverystillnationhandoldlifetellwritebecomehereshowhousebothbetweenneedmeancalldevelopunderlastrightmovethinggeneralschoolneversameanotherbeginwhilenumberpartturnrealleavemightwantpointformoffchildfewsmallsinceagainstasklatehomeinterestlargepersonendopenpublicfollowduringpresentwithoutagainholdgovernaroundpossibleheadconsiderwordprogramproblemhoweverleadsystemsetordereyeplanrunkeepfacefactgroupplaystandincreaseearlycoursechangehelpline

201-400

cityputclosecaseforcemeetoncewateruponwarbuildhearlightuniteliveeverycountrybringcenterletsidetryprovidecontinuenamecertainpowerpayresultquestionstudywomanmemberuntilfarnightalwaysserviceawayreportsomethingcompanyweekchurchtowardstartsocialroomfigurenaturethoughyounglessenoughalmostreadincludepresidentnothingyetbetterbigboycostbusinessvaluesecondwhyclearexpectfamilycompleteactsensemindexperienceartnextneardirectcarlawindustryimportantgirlgodseveralmatterusualratherperoftenkindamongwhitereasonactionreturnfootcaresimplewithinlovehumanalongappeardoctorbelievespeakactivestudentmonthdriveconcernbestdoorhopeexampleinformbodyeverleastprobableunderstandreacheffectdifferentideawholecontrolconditionfieldpassfallnotespecialtalkparticulartodaymeasurewalkteachlowhourtypecarryrateremainfullstreeteasyalthoughrecordsitdeterminelevellocalsurereceivethusmomentspirittraincollegereligionperhapsmusicgrowfreecauseserveagebookboardrecentsoundofficecutstepclasstruehistorypositionabovestrongfriendnecessaryaddcourtdealtaxsupportpartywhethereitherlandmaterialhappeneducationdeath

401-600

agreearmmotheracrossquiteanythingtownpastviewsocietymanageanswerbreakorganizehalffirelosemoneystopactualalreadyeffortwaitdepartmentablepoliticallearnvoiceairtogethershallcovercommonsubjectdrawshortwifetreatlimitroadlettercolorbehindproducesendtermtotaluniversityrisecenturysuccessminuterememberpurposetestfightwatchsituationsouthagodifferencestagefathertablerestbearentiremarketprepareexplainofferplantchargegroundwestpicturehardfrontliemoderndarksurfaceruleregarddancepeaceobservefuturewallfarmclaimfirmoperationfurtherpressurepropertymorningamounttopoutsidepiecesometimesbeautytradefeardemandwonderlistacceptjudgepaintmilesoonresponsibleallowsecretaryheartunionslowislandenterdrinkstoryexperimentstaypaperspaceapplydecidesharedesirespendsignthereforevariousvisitsupplyofficerdoubtprivateimmediatewishcontainfeedraisedescribereadyhorsesonexistnorthsuggeststationeffectivefooddeepwidealonecharacterEnglishhappycriticunitproductrespectdropnorfillcoldrepresentsuddenbasickillfinetroublemarksinglepressheavyattemptoriginstandardeverythingcommitteemoralblackredbadearthaccordelsemeredieremarkbasisexceptequaleasteventemploy

601-800

defensesmileriverimprovegamedetailaccountcentsortreduceclubbuyattentionshipdecisionwearinsidewinsupposerideoperaterealizesalechooseparksquarevotepricedistrictdeadforeignwindowbeyonddirectionstrikeinsteadtrialpracticecatchopportunitylikelyrecognizepermitseriousattackfloorassociationspringlotstocklackhairsciencerelationprofessionpatternquickmedicalinfluenceoccasionmachinecomparehusbandblueinternationalfairespeciallyindeedimaginesurpriseaverageofficialtemperaturedifficultsinghittreeracepolicetouchrelativethrowqualityformerpullchanceprovearguesettlegrowthdateheatsaveperformancecountproductionlistenmainpicksizecoolarmypatientcombinesummerhallslightcommandenjoylengthproperexpresshealthchiefeveningstorelanguagedegreelaycurrentgundoghotelstrangeseparateboatfailcleandressanyonegainpainobjectknowledgedependrelatebelowdollaradvanceshapearrangepopulationyessellmentiondrycheckpoetsleepjoinhotbedelectricdreamdueseasonmannerfitleftprogressneitherstrengthnoticefinishopinionbillwesterntruthwrongtravelsuitbankexacthonorbrotherquietmarrycornerhandledangerhospitalpoolpromisebloodshootsceneliteraturearrivefilmbasefreedombarmaybehangsuffermanufacturefrequentrocklossburn

801-1000

sunaudienceessentialglasspreventpoempoorinchsongskillpostpopularradioanimalconsciouswortheatelectionfaithwavemurdermodelforgetextendedgedistancememoryrecommenddivisionstafflegdiscussionaddressflydependentballshakeframeextremeengineerthickcomfortlattercampoildiscoverexaminedifficultytoothmiddlechoicereferenemypracticalmarriagebridgedeclareladycrossdailyafternoonattenddirectorbalancewashcapitalspeedblockcitizenmouthhillgreenpleasemotoragencyencouragegovernorworryaffairshoulderbrightmasssampleprettyrepeatrollpushtripcouncilclotheparentforwardsharpstraightgasweightdiscussfixloadmasterwhateverroundrapidlaughfingerspotproposeshopbroadreplacereplyextentlockemployeeaheadsightspreadwindapprovedestroynonepoundfameimportancereflectadvantagematchregularwagerefuseexistencehardlyperformtitletendexercisethincoatbitmountainyouthbehaviornewspapersecretabilityseasoftjusticereasonablecirclesolidpageweaponfastrepresentativesearchpureescapecrowdsticktelephoneavoidgardenfavornewsunlessdinnersomeonesignalyardidealwarmmisssheltersoldierarticlecrycaptainfamiliarseatguestweakexcitekingeveryonewineholedutybeatperfectbottomcomposebattleexpensecattleflowkitchendustbottleadmit

1001-1200

teartireexpressionexceptionapplicationbelongrichfailurestruggleinstrumentvarietynarrowtheatercollectionrainreviewpreserveleadershipclaydaughterfellowswingthanklibraryfatreservetournicewarnringbitterchairyesterdayscientificflowerwheelsolutionaimgatherinvitemoreoverfreshforestwinterboxbeliefordinaryimpossibleprintgraytastelipspeechreferencestainconnectionotherwisestretchknifevillageblowmistakesweetshoutdivideguardworseexchangerarecommercialrequestappointagentdependencebirdwildmotionguessneighborseedfashionloancorrectplainmailretireoppositeprefersafeevildoublewoodemptybabyadvisecontentsportliftliterarycurioustieflatmessageneckhatedirtdelighttrustnobodyvalleytoolpresencecookrailroadministercoffeebrushbesidecollectguideluckprofitlordeverybodyprisoncloudslavechairmansoildistinguishintroduceurgeblindariseuppercurvemembershipkeyentertainsoulneighborhoodfriendlypairstoneleanprotectadvertisemysterywelcomekneejumpsnakestreamavenuebrowndiseasehatexcellentformalsnowsheetsomehowunityskyroughsmoothweathersteadythreatendepthopposedeliverancientprayadoptbirthappearanceuniversebusyhurrycoastforthsmellfurnishfemalehidewireproposaloughtvictoryquarterenginecustomerwastefoolintendintentiondeskpoliticspassage

1201-1400

lawyerrootclimbmetalgradualhuntprotectionsatisfyroofbranchpleasurewitnessloosenoseminebandasiderisktomorrowremindearfishshoreoperatorcivilizebeingsilentscreenbindearnpackcolonybesidesslipcousinscalereliefexplorestembrainmusiciandefendbendsomebodyshadowmixsmokedescriptionfruitguiltyieldsensitivesaltpalesweepcompletionthroatagricultureadmiregentledozenparticlepleasantbaycupcompetitionmoonterriblestripmechanicshockconversationangletallplentystaryellowsickthoroughabsolutesucceedsurroundprouddearcardlakebreathafraidsilenceontoshoesomewherechainslidecopymachinerywakeseverepocketbonehonestfreezedictionarycalmswimicemaleskincrackrushwetmeatcommercejointgifthostsuspectpathuncleaffordinstantsatisfactoryheighttrackconfidencegrasssuggestionfavoritebreakfastapartchestentrancemarchsinknorthernironaliveillbagdisturbnativebedroomviolentbeneathpausetoughsubstancethreatcharmabsencefactoryspitemealuniversalaccidenthighwaysentencelibertywisenoisediscoverytubeflashtwistfencechildhoodjoysistersadefficiencydisappeardefeatextensiverentcomparisonpossessgracefleshliquidscientisteaseheavenmilksympathyrankrestaurantfrequencyangryshadeaccusenecessityknockloudpermanentrowlovelyconfusegoldfrightensolve

1401-1600

gravesalaryphotographadviceabroadwoundvirtuedarequeenextraattractnumerouspinkgateexpensiveshutchickenforgiveholywoodenpromptcrimesorryrepublicangervisitorpileviolencesteelwingstairpartnerdelaygentlemanpourconfusiondamagekicksafetyburstnetworkresistancescrewpridetillhireverbpreachclerkeverywhereanywayfanconnecteggefficientgraincalculatedragoppositionworshiparrestdisciplinestringharborcameramechanismcowgrandfunnyinsurancereductionstrictlessontightsandplatequalifyelsewheremadinterferencepupilfoldroyalvaluablewhisperanybodyhurtexcessquantityfunmudextensionrecognitionkisscropsailattractivehabitrelievewisdompersuadecertaintyclotheagerdeservesympatheticcuretrappuzzlepowderrawmankindgladblamewheneveranxietybustremblesacredfortunateglorygoldenneatweekendtreasuryovercomecatsacrificecomplainelectroarsaketempleselfcompetenursestuffstomachpeculiarrepairstormtondesertallowanceservanthungerconsciencebreadcrashtipstrengthenproofgeneroussirtonightwhiptonguemillmerchantcoalruinintroductioncourageactorbeltstirpackagepunishreflectionbreatheanywhereamusedullfatenetfellowshipfaultfurniturebeampencilborderdisappointflamejokeblesscornshelltemptsupperdestructiondiveanxiousshinecheapdishdistantgreetfloodexcuseinsect

1601-1800

oceanceremonydecreaseprizeharminsureversepotsincerecottonleafrubmedicinestrokebitelunglonelyadmissionstupidscratchcompositionbroadcastdrumresistneglectabsentpassengeradventurebegpipebeardboldmeanwhiledevilcheernutsplitmeltswearsugarburywipefaintcreaturetailwealthearnesttranslatesuspicionnobleinquiryjourneyhesitateextraordinaryborrowowefuneralambitionmixtureslopecriminalseldommapspinpraisespareplowtelegraphbarrelstraightenscarcelunchslaverycreepsweatgaystiffbraveseizeconvenienthorizonmoderatecomplicatedigcurseweighpriestexcessivequarrelwidowmodestdinepoliticiancustomeducatesalesmannailtapeasternpossessionsatisfactionbehavemercyscatterobjectionsilvertentsaddlewrapnestgrindspellplasterarchswellfriendshipbathbundlegratefulcrownboundarynowhereasleepclockboilaltogetherlendholidaypreciouswanderuglyreputationticketpretenddismissdelicatedespairawaketeafalsefortunecapthreadhastebareshirtbargainleatherrailbutterdotinquirewarmthdecisivevesselpitysteampinboundcompaniontoerewardforbidwherevertowerbathelodgeswallowmultiplybowkingdomgaragepermissionpumppreventionurgentauntzeroidlefeverChristmasregretjawsoappronounceempirebowloutlineorganimitationcautionmineraldisagreebladetricktreasureimmenseconveniencedisapprovedestructive

1801-2000

forknoonownershiptunepolishpoisonshameloyaltycottageastonishshavefeathersauceliddebtfadeconfessclassificationdescendcapemildcleverenvelopeinventionsheepsplendidstampfloatbrickricebusinessmanbackwardqualificationartificialattractionlampcurlshowerelderbunchbellsteerflavorspitrobcreaminterruptpenweaveorangerescuecrushhumblefancydecaypolitetribebleedcoinfondautumnclassifyomitloyalneedlelessencomplaintpadsteepskirtcurtaincalculationlaughtersolemngreaseinterfereexplodefastenflagresignpostponepatienceboastropeenvyairplaneridshieldveilkneeltrayexplosivebrasstaxiwaxduckbuttoninventremedybushthunderweakenpovertyscrapearrowtendercruelsoftenmousehayanyhowalikecircularjuiceshelfbakehatredcautiousbasketwreckwidthconfidentlogheapsuckladdergapobeyhutaxetranslationcollardeliveryreproduceconfessionpanprejudicevoyagetobaccosimplicitypastecakeelephantribbonharvestashamedcavecustomarythiefdampsewrustseparationwaiterpetstrawupsettowelrefreshessencefurambitiousdefendantdaylightdipsuspiciousimaginaryashcarriageeducatorsawstoverubberrugmiseryawkwardrivalroastdeedpreferenceexplosiontheatricalcultivatecollectormiserablewristrabbitaccustomtideinsultthumblumpannoytoyhealshallowrepetitionsoupwhistlescenery

2001-2200

appleoffensecorkripetempersorepinchdiamondrazorimaginativehookcopperlandlordinfluentialrothollowenclosehardenwickedstiffensilkuprightselfishstripepiginwardexcellencerakepurplehastenshortenapplauseacheapologyknotnephewcushiondrownnurserypintfierceimitatealoudgaietyrobberytightenperfectionscornwhoevertrunkwoolsailorcompetitormoonlightdeerbeaneverydaydrawerdisregardnowadayspatriotictinpennycagepardonlatelyoffendcoarsespoilhorizontalstingditchlibrarianmeantimecoughdeafswordmessengervaincastleelasticcombrodwidensorrowinventorcliffumbrellainterruptionmerrygallonconquestheadachetailorbucketscentsignaturecartdarkensometimeapplaudunderneathhellopretensedescentconquerframeworkconfidentialadoptiondisgustwaistmomentaryreceiptpearlraylazylimbgrammaticalbeastmonkeyjewelpersuasionobediencesockvowelhammerinnchimneydissatisfactionannoyanceornamenthonestyoutwardsharpenhandkerchiefgreedheavenlythirstniecespillloafwheatwormsecrecyrudeheightenflattenloosencheeserivalryroyaltydiscontentcomplicationfrightindoorflouractresscongratulationouncefryeverlastinggoatinkdisappearancereproductionthickenavoidancespoonstrapdeceivelengthenrevengecorrectiondescendanthesitationspadebasinweedomissionold-fashionedbicyclebreadthphotographycowardmatrejoicecheatcongratulatediscomfortenclosureattentivepawoverflowdissatisfymultiplicationwhichevertidybribemendstocking

2201-2284

feastnuisancethorntameinclusivehomemadehandwritingchalksourslipperyprocessionripenjealousjealousyliarhomecomingbarberwhitenberrylightenpigeonhinderbraverybaggagenounamongstgrammarcultivationcompanionshiprubbishmodestywoolendeepenpastrycupboardquartcanalnotebookdeceitparcelbrightenmoderationpunctualhurrahlipstickuppermostfattenconquerorhindrancecowardiceobedientsaucermaddenscoldweekdayrottendisrespectwidowerdeafendonkeybusinesslikemotherhoodsaddenhandshakecalculatorheaddressscissorstranslatorpossessorshillingreddenmotherlywhosecultivatorwhomhomeworkelectricianoarbriberysweetensowpronunciationbeakplural


Online Test A
 
Reading Boot Camp    Test A     
Name:
 
Instructions: Choose the best answer for each question.
1.                  to cause someone to be angry or upset.
 ache
 admire
 annoy
 anxiety
2.                  the time of day between noon and evening.
 afternoon
 ache
 ambition
 absence
3.                  to have enough money for; be able to pay for.
 absolutely
 annoy
 afternoon
 afford
4.                  to clap the hands in approval.
 anxiety
 applaud
 apologize
 afternoon
5.                  away from each other in time or space.
 angle
 agriculture
 accuse
 apart
6.                  real; true; exact.
 abroad
 actual
 approve
 ambition
7.                  a feeling of being worried, nervous, or afraid that something bad will happen.
 accustom
 anxiety
 angle
 annoy
8.                  to say that you are sorry.
 apologize
 actual
 accustom
 abroad
9.                  to have a high opinion of; respect.
 accident
 ambition
 admire
 accuse
10.              a strong desire to reach a goal, or the goal that someone wants to reach.
 approve
 ambition
 anxiety
 agriculture
11.              before; in front.
 accident
 anxiety
 ahead
 abroad
12.              the figure made by two lines coming from a single point.
 angle
 accustom
 accident
 advice
13.              to say that someone has done something wrong or illegal.
 anxiety
 admire
 accuse
 accustom
14.              to say that you accept something; to say yes to something.
 amuse
 admire
 approve
 apologize
15.              to have a dull pain that lasts a long time.
 approve
 ache
 accuse
 ambition
16.              in or to another country.
 absence
 applaud
 advertise
 abroad
17.              reasons or causes that are not planned by anyone.
 absolutely
 applaud
 apart
 accident
18.              to cause to smile or laugh.
 indent
 amuse
 apart
 abroad
19.              together with or in the middle of.
 absence
 angle
 annoy
 among
20.              precisely; exactly.
 absolutely
 accustom
 afternoon
 admire
21.              to become used to or familiar with something over time.
 afternoon
 accuse
 absolutely
 accustom
22.              the science or activity of farming. __________ includes raising crops and animals for food.
 agriculture
 apologize
 advice
 applaud
23.              to tell about something so people will want to buy it.
 accident
 ahead
 advice
 advertise
24.              an idea or opinion that someone gives to help you decide.
 afternoon
 afford
 advertise
 advice
25.              a time of being away or not present.
 amuse
 anxiety
 absence
 actual